30-MINUTE MEALS! Get the email series now
Mood Cooks

One Pot Creamy Garlic Pasta

5 from 1 vote
1 Comments
Olivia
By: OliviaUpdated: Nov 30, 2025
This post may contain affiliate links. Please read our disclosure policy.

A comforting one pot creamy garlic pasta that comes together quickly with pantry staples and delivers rich, silky sauce with minimal fuss.

One Pot Creamy Garlic Pasta

This creamy garlic pasta has been my go to for busy weeknights and lazy Sundays alike. I discovered this approach the first winter I lived alone, when I wanted something warm, indulgent, and simple to cook without a sink full of dishes. The technique of cooking the dry pasta directly in milk and a little water yields a sauce that clings to every strand or tube, giving a luxurious mouthfeel without constant stirring or a separate cheese sauce. The garlic sings through the cream and Parmesan, producing an aroma that always draws people into the kitchen.

What makes this version special is how forgiving it is. It takes pantry staples, a single pot, and basic technique to produce something that tastes restaurant worthy. The texture is creamy but not heavy, the cheese melts into a silky coating, and the garlic provides a bright backbone. Over the years I have served this to friends who expected simple comfort food and left impressed, and my family requests it when time is short but good flavor is required. You will notice small golden specks of garlic and flecks of seasoning that together create a balanced bowl of comfort.

Why You'll Love This Recipe

  • This recipe comes together quickly and requires one pot, making cleanup minimal and weeknight cooking easier.
  • It uses pantry staples such as dried pasta, milk, and Parmesan so you can make it without a special grocery run.
  • The technique of cooking pasta in milk and a little water creates a naturally creamy sauce, no roux or heavy cream required.
  • Flexible to dietary swaps, you can use alternative milks or add vegetables and proteins to adapt it for different tastes.
  • Ready in about 20 minutes when using a high simmer, ideal for busy evenings when you want comfort without effort.
  • Make ahead potential is good for refrigerator storage and gentle reheating preserves texture with a splash of milk.

My friends call this the dish that proves simple food can be memorable. The first time I served it at a small dinner, a guest asked for the recipe before dessert arrived. That kind of reaction is common with this dish and it always feels satisfying to share such a reliable, comforting bowl.

Ingredients

  • Pasta: Eight ounces of dried spaghetti, linguine, or penne works well. Choose a reliable brand and cook time on the package as a guide. The shape affects how sauce clings, penne catches sauce inside the tubes while long strands make for silky coating.
  • Fat: One tablespoon of butter or olive oil adds richness and helps gently sauté the garlic without burning. Use unsalted butter for better salt control or a neutral oil if you prefer.
  • Garlic: Four cloves of garlic, minced, provide aromatic foundation. Fresh garlic gives the best flavor so avoid pre-minced jars for this recipe when possible.
  • Milk: Two cups of whole milk are preferred for richness. You can use 2 percent or a culinary oat milk for dairy free needs, though texture will vary slightly.
  • Water: One cup of water or just enough to barely cover the pasta. This extra liquid helps the pasta cook and keeps the sauce from becoming too thick before the pasta is done.
  • Cheese: Three quarters cup freshly grated Parmesan cheese gives savory umami and creaminess. Freshly grated melts better than pre-grated blends.
  • Seasoning: Half teaspoon salt, quarter teaspoon black pepper, and one teaspoon Italian seasoning bring balanced flavor. Adjust salt at the end after tasting, as Parmesan is salty.
  • Optional additions: Two tablespoons cream cheese or sour cream for extra silkiness, and chopped parsley or basil for garnish and freshness.
Pasta ingredients laid out

Instructions

Sauté GarlicPlace a large pot or deep skillet over medium heat and add one tablespoon of butter or oil. When the fat is shimmering, add four cloves of minced garlic and stir constantly for one to two minutes until fragrant and lightly golden. Watch closely to avoid browning which will impart bitterness.Add Pasta and LiquidAdd the dry eight ounces of pasta to the pot then pour in two cups of milk and one cup of water or enough to just barely cover the pasta. Stir the mixture so the pasta does not stick together and bring to a gentle boil over medium heat. If using long pasta, push strands down carefully as the liquid softens them.Cook the PastaReduce heat to a low simmer and cook uncovered, stirring frequently to prevent sticking and to encourage even cooking. Simmer for eight to ten minutes or until the pasta reaches al dente and most of the liquid has reduced into a creamy sauce. Adjust heat to maintain a gentle simmer without boiling over.Stir in Cheese and SeasoningRemove the pot from heat, then stir in three quarters cup freshly grated Parmesan cheese, half teaspoon salt, quarter teaspoon black pepper, and one teaspoon Italian seasoning. Keep stirring until the cheese melts into a smooth sauce. For extra richness, fold in two tablespoons cream cheese or sour cream until fully incorporated.Serve and GarnishDivide pasta into bowls and garnish with chopped parsley or basil. Taste and adjust salt or pepper if necessary. Serve immediately while hot for best texture and flavor.Creamy garlic pasta in a serving bowl

You Must Know

  • This dish stores well in the refrigerator for up to three days. Reheat gently with a splash of milk to revive the sauce.
  • Leftovers freeze okay for up to three months, though texture is best when reheated slowly over low heat.
  • The recipe is high in calcium and provides moderate protein from the cheese and milk.
  • Adjust salt after adding Parmesan since the cheese contributes a significant portion of the sodium.
  • Using freshly grated cheese and whole milk yields the creamiest result.

One of my favorite aspects is how this recipe scales. I often double it for potlucks and then everyone asks for the timing I used. The simplicity makes it a reliable base for adding roasted vegetables or cooked chicken, turning a quick plate into a satisfying meal with minimal extra effort. Family members say it tastes just as comforting as classic restaurant pasta but with a homey aroma that makes it feel personal.

Storage Tips

Allow the pasta to cool to near room temperature before refrigerating, then transfer it to an airtight container. It will stay fresh for up to three days. To reheat, add a splash of milk or water to loosen the sauce and warm gently over low heat while stirring. Avoid high heat which can separate the sauce. For freezing, portion into meal sized containers and freeze for up to three months. Thaw overnight in the refrigerator before reheating to preserve texture.

Ingredient Substitutions

If you need a dairy free version, use a full fat unsweetened oat milk and a dairy free parmesan style cheese along with a tablespoon of vegan butter for mouthfeel. For lower fat, use 2 percent milk and skip the cream cheese. Whole wheat or legume based pasta can be used for more fiber and protein, though cook times may vary. If you prefer deeper flavor, swap half the milk for low sodium chicken or vegetable broth but keep some milk for creaminess.

Garnished pasta close up

Serving Suggestions

Serve alongside a crisp green salad tossed with lemon vinaigrette to cut through the richness. Add roasted broccoli or sautéed spinach on the side for color and texture. For a heartier meal, top with grilled chicken, cooked shrimp, or pan seared mushrooms. Finish with extra grated Parmesan and a scattering of fresh herbs for brightness before bringing to the table.

Cultural Background

One pot pasta methods are a recent innovation in home kitchens, though they draw on classic Italian principles of making sauce and pasta form a single harmonious dish. Cooking pasta directly in a flavored liquid allows the starch to thicken the sauce naturally. This approach is practical, modern, and rooted in the same culinary logic that Italian home cooks have used for generations to marry starches and sauces.

Seasonal Adaptations

In spring and summer, stir in fresh peas and lemon zest for lift. In autumn, fold in roasted squash and sage for a warm twist. During winter, add wilted kale and a pinch of red pepper flakes for heat. The base technique remains the same and seasonal ingredients can be added at the end so they keep texture and flavor.

Meal Prep Tips

For weekly meal prep, cook the pasta slightly under al dente so reheating does not overcook it. Portion into individual containers and refrigerate. When reheating, use a low flame and add a splash of milk or water, stirring until the sauce loosens. If adding protein or vegetables, store them separately and combine at the time of reheating for best texture.

This recipe is a celebration of simple technique and reliable flavor. I encourage you to make it your own by experimenting with add ins and garnishes. It rewards small tweaks and always delivers on comfort.

Pro Tips

  • Grate Parmesan fresh for better melting and clearer flavor.

  • Stir frequently while simmering to prevent the pasta from sticking and to build the sauce.

  • Adjust salt at the end because Parmesan adds saltiness.

  • Use whole milk for the creamiest texture or add cream cheese for extra silkiness.

This nourishing one pot creamy garlic pasta recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

FAQs about Recipes

How long will leftovers last?

Yes, refrigerate in an airtight container for up to three days and reheat gently with a splash of milk.

Can I make this dairy free?

Use unsweetened oat milk and a dairy free Parmesan alternative while following the same technique. Texture varies slightly.

Tags

Easy Weeknight Dinnerspastaone-potgarliccreamyrecipeweeknight-dinneritalian
No ratings yet

One Pot Creamy Garlic Pasta

This One Pot Creamy Garlic Pasta recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 2 steaks
One Pot Creamy Garlic Pasta
Prep:5 minutes
Cook:12 minutes
Rest Time:10 mins
Total:17 minutes

Ingredients

Pasta and Dairy

Liquids

Seasoning

Instructions

1

Sauté Garlic

Melt butter or heat oil in a large pot over medium heat. Add minced garlic and sauté for one to two minutes until fragrant and lightly golden, stirring to prevent burning.

2

Add Pasta and Liquid

Add dry pasta to the pot then pour in milk and enough water to just cover the pasta. Stir to combine and bring to a gentle boil so pasta begins to soften.

3

Simmer Until Al Dente

Reduce to a low simmer and cook uncovered, stirring frequently for eight to ten minutes until pasta is al dente and liquid has reduced to a creamy consistency.

4

Incorporate Cheese and Seasoning

Remove from heat and stir in freshly grated Parmesan, salt, pepper, and Italian seasoning. Add cream cheese or sour cream if using and stir until smooth.

5

Serve

Plate immediately, garnish with chopped parsley or basil, then serve hot. Taste and adjust seasoning if needed before serving.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 420kcal | Carbohydrates: 45g | Protein:
18g | Fat: 14g | Saturated Fat: 4g |
Polyunsaturated Fat: 3g | Monounsaturated Fat:
6g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@moodcooks on social media!

One Pot Creamy Garlic Pasta

Categories:

One Pot Creamy Garlic Pasta

Did You Make This?

Leave a comment & rating below or tag @moodcooks on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Olivia!

Chef and recipe creator specializing in delicious Easy Weeknight Dinners cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.